The Sentient Expert Query prepares queries for submission to multiple web-interfaced Life Science databases. If you use one or more of the over 100 websites for these databases, it will accelerate your research. Save, refine, and rerun queries that otherwise take a lot of manual entry each time. The query enters the terms in the target database search engine. It doesn’t return irrelevant non scientific responses.

This is not a web search tool like Google, which searches HTML-based “web pages,” but not databases. The Expert Query searches web-based databases!

The Expert Query allows Life Scientists to enter single or multiple search terms into specific fields (such as journal title, author, protein sequence, etc.) for single-click submission to multiple databases. While web search tools are excellent at finding every place on the web that the text (for example) “protein related to cancer” exists on the web, they are actually quite poor finding (for example) where a particular protein sequence, related to a specific disease, is located in peer-reviewed proteomics databases.

For example, I want to search for a membrane envelope protein in mouse, acting as activator, and containing a specific sequence motif (in this example, MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQ). If I try to enter the protein sequence in Google, I get an error returned. If I omit the sequence motif and enter the other terms, I get 128,000 to 132,000 hits (depending on the order of the terms), none of which refers to the correct proteins.

So I enter this query in the Sentient Expert Query:

I learn that 33 of the over 100 databases can handle one or more of the terms, and I am told which of the databases handle which terms. One database can handle all terms, so I click on the result from it first, which results in precisely 3 protein hits: 2 phosphorylation sites and a double-stranded RNA binding site. I can save my query, refine it, and rerun it tomorrow or in a week.

Sentient Expert Query provides the field joining within database functionality for you, and you don’t have to know or worry about the syntax for different sites. You enter your query once to directly search multiple fields simultaneously, from multiple databases. Be confident that you have quickly and comprehensively searched the high quality scientific databases related to your discipline - not just anyone's web page!”