Sentient Expert Query - Example
Go to Login PageToday, for instance, I might try using Google to search for a membrane envelope protein in a mouse model, acting as activator, and containing a specific sequence motif (MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQ). A search by protein sequence in Google returns an error. Omitting the sequence motif and searching just with the other terms, though, retrieves 128,000–132,000 hits (depending on the order of the terms). If I bothered to look through all of them, I’d discover that precisely none of them refers to the correct proteins.
But what happens if I enter this query in Sentient Expert Query?
- Keyword=activator
- Organelle=cell membrane
- Organism Species=mouse
- Sequence=MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQ
- Description=envelope protein
I click to search, and Sentient Expert Query tells me that 33 databases can handle one or more of the terms. I also receive a list telling me which databases can handle which terms. One database can handle all terms, so, naturally, I check that result first. I find three protein hits: two phosphorylation sites and a double-stranded RNA binding site. I can begin acting on this discovery or, if I prefer, I can save the query, refine it, and rerun it anytime.